Pantoea stewartii subsp. stewartii: DSJ_14095
Help
Entry
DSJ_14095 CDS
T04970
Name
(GenBank) LysR family transcriptional regulator
Organism
pstw
Pantoea stewartii subsp. stewartii
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LysR_substrate
HTH_1
fvmX1
Motif
Other DBs
NCBI-ProteinID:
ARF50349
UniProt:
H3RCZ2
LinkDB
All DBs
Position
complement(2835102..2836004)
Genome browser
AA seq
300 aa
AA seq
DB search
MNIELRHLRYFIAVAEELHFGRAAQRLHISQPPLSQQIMHLEAETGAQLFNRTNRSVQLT
PAGQQFLQDARAILLQVEQATQRAARLHRGEEGELRIGFTSSAAFIGVVSDALYLFRQRW
PDVHVQMQEINTRQQLTPLHEGKLDLGVMRNTPLPADLHHQLLLQEPLCAVVHKAHPLAS
AGKISLQALASEPFVFFDPQVGTALYSEILDLLQRYQIKPYITQEVGEAMTILGLVATGL
GVSILPASFSHARLTNVVWLPLEEPDALSEMWLVWSAQREMSVQMAHMMALLRRENERSR
NT seq
903 nt
NT seq
+upstream
nt +downstream
nt
atgaatatcgagctgcgtcaccttcgttattttattgccgttgcagaagagctgcatttt
ggccgcgcggcgcaacggctgcatatttctcagccgccgctcagtcagcaaatcatgcac
cttgaggcagaaaccggggcgcagctgtttaaccgcaccaaccgcagcgtgcagctcacg
ccggccgggcaacaatttttgcaggatgcgcgcgccattctgttgcaggttgagcaggcg
acccagcgtgcggcacgactacatcggggagaagaaggggaactgcgcatcggctttacc
tcctctgccgcttttattggtgtcgtctcggatgcgctctacctgtttcgccagcgctgg
cctgatgttcatgttcagatgcaggaaatcaatacccggcagcagctgacgccgctccat
gaagggaaactcgatttgggtgtgatgcgcaacacgccgctgcctgccgatctgcatcat
caactgctattacaggagccgctatgcgcggtggtgcacaaagcccatccgctggcgtcc
gccgggaagatttctttacaggcgctggccagtgagccttttgtctttttcgatccgcag
gtgggaacggcgctttacagcgaaatactcgatttactgcaacgctatcagatcaaaccc
tatatcactcaggaagtgggcgaggcgatgacaattctcggtctggtcgcgaccggttta
ggcgtgtctattttaccggcatcgttcagccatgcccgcctgacgaatgtcgtctggctg
ccgcttgaggaaccggatgcactttcggaaatgtggctggtctggtctgcgcaacgggaa
atgagcgtgcagatggcccatatgatggcgctgttgcggcgggaaaacgaacgctctcgc
taa
DBGET
integrated database retrieval system