Pedobacter steynii: BFS30_00570 Help Entry BFS30_00570       CDS       T04469                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psty  Pedobacter steynii Pathway psty01100   Metabolic pathways psty01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psty00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BFS30_00570    00074 Mycolic acid biosynthesis     BFS30_00570   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BFS30_00570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOM75795 UniProt:  A0A1D7QAX4 LinkDB All DBs Position 138905..139159 Genome browser AA seq 84 aa AA seqDB search MDRQLLLSKLKTIVASYSHDKDALEYLSETTDFTKDLKINSANLVDVVLDVEEEFDIEID NLSMERMLNISAAIEIIESKLKEK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggatagacaattattactctcaaaattaaaaaccattgttgccagctatagtcatgac aaggatgctttagaatacctcagcgaaaccaccgatttcacaaaagacctgaaaatcaat tctgccaatctggtggatgtagtactggatgtcgaagaagagttcgacattgaaatagac aatctttctatggaacgtatgctcaatatcagcgctgctatagaaattatagaaagtaaa ctgaaagagaagtga

DBGET integrated database retrieval system