Pedobacter steynii: BFS30_03085 Help Entry BFS30_03085       CDS       T04469                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism psty  Pedobacter steynii Pathway psty00362   Benzoate degradation psty01100   Metabolic pathways psty01120   Microbial metabolism in diverse environments psty01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:psty00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     BFS30_03085    00622 Xylene degradation     BFS30_03085    00621 Dioxin degradation     BFS30_03085 Enzymes [BR:psty01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      BFS30_03085 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  AOM76232 UniProt:  A0A1D7QC26 LinkDB All DBs Position 750592..750813 Genome browser AA seq 73 aa AA seqDB search MPYVKIEVTREGVTREQKQALIKGVTDLMTEVLNKDPQLTFVVIQEYDLDNWGHAGEQVS VLREKGITAERKK NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgccatacgtaaaaatagaagtgacccgcgaaggggttaccagggagcaaaagcaagcc ctgatcaaaggggtaactgacctgatgactgaagtattaaataaagaccctcaattaacc tttgtagtgatccaggaatatgacctggacaactggggccatgccggagagcaggtatct gtactcagggaaaaagggataaccgctgaaagaaaaaaataa

DBGET integrated database retrieval system