Pedobacter steynii: BFS30_22660 Help Entry BFS30_22660       CDS       T04469                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism psty  Pedobacter steynii Pathway psty03060   Protein export psty03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:psty00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     BFS30_22660  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     BFS30_22660  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:psty02044]     BFS30_22660 Secretion system [BR:psty02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    BFS30_22660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AOM79712 UniProt:  A0A1D7QM23 LinkDB All DBs Position complement(5488005..5488250) Genome browser AA seq 81 aa AA seqDB search MILLEFLNMGSGEILLILAVVLLLFGGKKLPELARGLGKGIRDFKDASEGVKREIHRNIN VVNADDEPVSTETKEPIIPKN NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgatcttactcgaatttctaaatatgggcagtggtgaaatcctgctgatcctcgcagtt gtcctgttgttgtttggaggtaaaaaactacctgaacttgcccgtggactggggaaagga atcagggatttcaaggatgcttccgaaggtgtaaaacgtgaaattcacaggaatatcaat gttgtaaatgcagacgatgaacctgtaagcacagaaacaaaagaaccaattattccaaaa aactaa

DBGET integrated database retrieval system