Pseudoxanthomonas suwonensis 11-1: Psesu_2002 Help Entry Psesu_2002        CDS       T01403                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psu  Pseudoxanthomonas suwonensis 11-1 Pathway psu01100   Metabolic pathways psu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Psesu_2002    00074 Mycolic acid biosynthesis     Psesu_2002   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Psesu_2002 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  ADV27839 UniProt:  E6WUR5 LinkDB All DBs Position complement(2213235..2213474) Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTNSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYIKAHVKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgtcgtcgaacagctcggcgtcaaggaa gaggaagtgaccaacagcgcatcgttcgtcgacgacctgggcgccgactcgctcgacacc gtcgagctggtgatggccctggaagaagagttcgagtgcgagatcccggacgaagaggcc gagaagatcacctcggtccagcaggcgatcgactacatcaaggcccacgtcaagagctga

DBGET integrated database retrieval system