KEGG   Candidatus Planktophila sulfonica: A1sIA56_04475
Entry
A1sIA56_04475     CDS       T05158                                 
Name
(GenBank) spermidine/putrescine transport system ATP-binding protein
  KO
K11072  spermidine/putrescine transport system ATP-binding protein [EC:7.6.2.11]
Organism
psuf  Candidatus Planktophila sulfonica
Pathway
psuf02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:psuf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A1sIA56_04475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psuf02000]
    A1sIA56_04475
Enzymes [BR:psuf01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.11  ABC-type polyamine transporter
     A1sIA56_04475
Transporters [BR:psuf02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Spermidine/putrescine transporter
    A1sIA56_04475
SSDB
Motif
Pfam: ABC_tran TOBE_2 AAA_21 OB_MalK SMC_N AAA_22 AAA_25 AAA ORC-CDC6-like Rad17 AAA_16 SRP54 DUF4869 nSTAND3 AAA_23 AAA_28
Other DBs
NCBI-ProteinID: ASY16155
UniProt: A0A249KHH5
LinkDB
Position
complement(895171..896322)
AA seq 383 aa
MSEKAISARGDLKLSNITKSYGDFTAVNDLSLVIPEGSFFALLGPSGCGKTTTLRMIAGL
EEPTKGSISLGATDITDTKPYQRPINTVFQNYALFPHLTIFENIAFGLRRRGIKDVDSAV
SKALDLVELPHLAQRKPTQLSGGQQQRIALARAIVNRPALLLLDEPLGALDLKLRRQMQI
ELKWIQKEVGLTFVHVTHDQEEAMTMADTIAVMNEGEIEQMGSPADLYDNPETAFVANFL
GQSNLIKGTVTGNDGANQIVDLFGQKISLQKNRSHAVDNSIYAGIRPEKFRISRLETATS
GNVLTGGKVEDVSYIGVSTQYQVMMPWGQELMVFEQNDDGVAPFSVGESVNISWEPIFTF
GLRGDEDAEAGTEVNPDEDLDEE
NT seq 1152 nt   +upstreamnt  +downstreamnt
gtgtcagaaaaggctatctctgcacgcggggatctcaagctcagcaatatcaccaagtca
tacggtgatttcacagcagtaaatgatttgtcgcttgtcattcctgaaggttcattcttt
gcattgcttggaccttcaggatgcggcaagacaacaacgctacgaatgattgcagggctt
gaagaaccaactaaaggcagcatctcattaggcgcaactgatattacggatacaaagccg
tatcagcgtccaatcaatactgtctttcagaattacgcgctctttccgcacctgacaatc
tttgaaaatatcgcattcggccttcgccgtcgcggaataaaagatgtagatagtgcagtg
agtaaggcgcttgatcttgtagagcttcctcaccttgcacaacgcaaaccaacacaactt
tcaggtgggcagcagcagcgcatcgcacttgctcgcgcaatcgttaaccgtccagcgctc
ttgcttctcgatgagccactcggcgcactcgatctcaagcttcgtcgtcagatgcagatt
gaactcaagtggatccagaaagaagttggtctcacattcgttcacgtaactcacgatcag
gaagaagccatgactatggctgacaccatcgcggttatgaacgagggcgagatcgagcag
atgggttcacctgctgatctgtatgacaatcccgaaacagcattcgttgctaacttcttg
ggtcagtcaaacctcattaagggaactgtcaccggaaacgatggcgcaaatcagattgtt
gatctcttcggacagaagatttcattgcagaagaatcgttcacatgcagtagataactca
atatatgcaggcatccgccctgaaaagttccgtatttcgcgtcttgaaacagcgacatca
ggcaacgttcttacaggtggcaaagttgaagatgtttcctacatcggcgtttcaactcag
taccaagtaatgatgccgtggggacaagagctcatggtcttcgaacaaaatgatgatggc
gttgcaccatttagcgtcggcgaatccgtcaacatttcttgggaaccaatctttaccttc
ggtcttcgcggagatgaagatgctgaagcaggtactgaagtaaaccctgatgaggatctc
gacgaagaatga

DBGET integrated database retrieval system