Phytohabitans suffuscus: Psuf_000460 Help Entry Psuf_000460       CDS       T06545                                  Name (GenBank) hypothetical protein   KO K16025   methoxymalonate biosynthesis acyl carrier protein Organism psuu  Phytohabitans suffuscus Pathway psuu01051   Biosynthesis of ansamycins psuu01052   Type I polyketide structures Brite KEGG Orthology (KO) [BR:psuu00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01052 Type I polyketide structures     Psuf_000460    01051 Biosynthesis of ansamycins     Psuf_000460  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:psuu01008]     Psuf_000460 Polyketide biosynthesis proteins [BR:psuu01008]  Polyketide tailoring proteins   Others    Psuf_000460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  BCB82733 UniProt:  A0A6F8Y9N3 LinkDB All DBs Position 85159..85428 Genome browser AA seq 89 aa AA seqDB search MTSASQALEADLTDLLERRTKIPVAPDADLFELGVVSSLFAMELVVHLESTYDIAIVGPD LVMENFRSVQAMAALVRRIQDRVGAGTGV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt gtgacttctgccagccaggccctcgaggcggacctgacggatctgctggagcggcgcacc aagatcccggtggcaccggacgccgacctgttcgagctcggcgtggtctcctcgctgttc gccatggagctcgtggtccacctcgagtccacatacgacatcgcgatcgtcggccccgac ctggtgatggagaacttccggtcggtccaggcgatggctgcgctcgtacgacggatccag gaccgggtcggtgcgggcaccggtgtctga

DBGET integrated database retrieval system