Phytohabitans suffuscus: Psuf_004050 Help Entry Psuf_004050       CDS       T06545                                  Name (GenBank) hypothetical protein   KO K00128   aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] Organism psuu  Phytohabitans suffuscus Pathway psuu00010   Glycolysis / Gluconeogenesis psuu00053   Ascorbate and aldarate metabolism psuu00071   Fatty acid degradation psuu00280   Valine, leucine and isoleucine degradation psuu00310   Lysine degradation psuu00330   Arginine and proline metabolism psuu00340   Histidine metabolism psuu00380   Tryptophan metabolism psuu00410   beta-Alanine metabolism psuu00561   Glycerolipid metabolism psuu00620   Pyruvate metabolism psuu00625   Chloroalkane and chloroalkene degradation psuu00770   Pantothenate and CoA biosynthesis psuu01100   Metabolic pathways psuu01110   Biosynthesis of secondary metabolites psuu01120   Microbial metabolism in diverse environments psuu01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:psuu00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     Psuf_004050    00053 Ascorbate and aldarate metabolism     Psuf_004050    00620 Pyruvate metabolism     Psuf_004050   09103 Lipid metabolism    00071 Fatty acid degradation     Psuf_004050    00561 Glycerolipid metabolism     Psuf_004050   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     Psuf_004050    00310 Lysine degradation     Psuf_004050    00330 Arginine and proline metabolism     Psuf_004050    00340 Histidine metabolism     Psuf_004050    00380 Tryptophan metabolism     Psuf_004050   09106 Metabolism of other amino acids    00410 beta-Alanine metabolism     Psuf_004050   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     Psuf_004050   09109 Metabolism of terpenoids and polyketides    00903 Limonene degradation     Psuf_004050   09111 Xenobiotics biodegradation and metabolism    00625 Chloroalkane and chloroalkene degradation     Psuf_004050 Enzymes [BR:psuu01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.1  With NAD+ or NADP+ as acceptor     1.2.1.3  aldehyde dehydrogenase (NAD+)      Psuf_004050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Aldedh DUF1487 Motif Other DBs NCBI-ProteinID:  BCB83092 UniProt:  A0A6F8YAF2 LinkDB All DBs Position complement(475697..476044) Genome browser AA seq 115 aa AA seqDB search MEPTVFAGVTNDMVIAQEEIFGPVVGVLAFEDEDEAVRIANDSAYGLAAGVWTADLSRAH RVAAQLQVGTVWVNTYNVFDPALSFGGRKGSGLGRDLGDEALRGYLEPKAVVVGL NT seq 348 nt NT seq  +upstreamnt  +downstreamnt gtggagcccaccgtcttcgccggcgtcaccaacgacatggtcatcgcccaggaagagatc ttcgggccggtcgtcggcgtactggccttcgaggacgaggacgaggcggtacggatcgcc aacgactcggcgtacggcctggccgccggggtctggacggccgacctgagccgggcccat cgggtcgccgcccagctgcaggtcgggacggtctgggtcaacacctacaacgtgttcgac ccggcgctctccttcggcgggcgcaagggttcgggtctcggccgtgacctcggcgacgag gccctgcgcggctacctggagccgaaggcggtcgtcgtaggtctgtga

DBGET integrated database retrieval system