Phytohabitans suffuscus: Psuf_013520 Help Entry Psuf_013520       CDS       T06545                                  Name (GenBank) hypothetical protein   KO K00382   dihydrolipoyl dehydrogenase [EC:1.8.1.4] Organism psuu  Phytohabitans suffuscus Pathway psuu00010   Glycolysis / Gluconeogenesis psuu00020   Citrate cycle (TCA cycle) psuu00260   Glycine, serine and threonine metabolism psuu00280   Valine, leucine and isoleucine degradation psuu00310   Lysine degradation psuu00380   Tryptophan metabolism psuu00620   Pyruvate metabolism psuu00630   Glyoxylate and dicarboxylate metabolism psuu00640   Propanoate metabolism psuu00670   One carbon pool by folate psuu00785   Lipoic acid metabolism psuu01100   Metabolic pathways psuu01110   Biosynthesis of secondary metabolites psuu01120   Microbial metabolism in diverse environments psuu01200   Carbon metabolism psuu01210   2-Oxocarboxylic acid metabolism psuu01240   Biosynthesis of cofactors Module psuu_M00009   Citrate cycle (TCA cycle, Krebs cycle) psuu_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate psuu_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA psuu_M00621   Glycine cleavage system Brite KEGG Orthology (KO) [BR:psuu00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     Psuf_013520    00020 Citrate cycle (TCA cycle)     Psuf_013520    00620 Pyruvate metabolism     Psuf_013520    00630 Glyoxylate and dicarboxylate metabolism     Psuf_013520    00640 Propanoate metabolism     Psuf_013520   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     Psuf_013520    00280 Valine, leucine and isoleucine degradation     Psuf_013520    00310 Lysine degradation     Psuf_013520    00380 Tryptophan metabolism     Psuf_013520   09108 Metabolism of cofactors and vitamins    00785 Lipoic acid metabolism     Psuf_013520    00670 One carbon pool by folate     Psuf_013520  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psuu04147]     Psuf_013520 Enzymes [BR:psuu01000]  1. Oxidoreductases   1.8  Acting on a sulfur group of donors    1.8.1  With NAD+ or NADP+ as acceptor     1.8.1.4  dihydrolipoyl dehydrogenase      Psuf_013520 Exosome [BR:psuu04147]  Exosomal proteins   Exosomal proteins of breast cancer cells    Psuf_013520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pyr_redox_dim Pyr_redox_2 Motif Other DBs NCBI-ProteinID:  BCB84039 UniProt:  A0A6F8YDE2 LinkDB All DBs Position 1485173..1485715 Genome browser AA seq 180 aa AA seqDB search MERGFVLTDDRLRTSVPNVFAVGDIVPGLQLAHRGFQQGIFVAEEIAGKNPAPIDEAGIP RVTYSDPEVASMGLTEAKAKEKYGADKVQAYNYNLGGNGKSQILRTQGFVKLVRVADGPV VGVHMVGARVGELIGEAQLIYNWEAYPAEVAQLVHAHPTQNEALGEAHLALAGKPLHAHA NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atggagcgcggcttcgtcctcaccgacgaccgcctgcgcaccagcgtgcccaacgtcttc gcggtcggcgacatcgtccccggcctccagctcgcgcaccgcggcttccagcagggcatt ttcgtggccgaggagatcgcgggcaaaaacccggcgccgatcgacgaggccggcatcccc cgggtcacctactccgaccccgaggtcgcgtcgatgggactgaccgaggcgaaggccaag gagaagtacggcgccgacaaggtgcaggcgtacaactacaacctcggcggcaacggcaag agccagatcctgcgcacccagggcttcgtcaagctggtccgggtggcggacggtccggtg gtcggtgtgcacatggtcggcgcccgcgtcggcgagctgatcggtgaggcgcagctcatc tacaactgggaggcctacccggccgaggtcgcccagctggtccacgcacaccccacgcag aacgaggcgctcggcgaggcccacctcgccctcgcgggcaagcccctgcacgcccacgcc tga

DBGET integrated database retrieval system