KEGG   Phytohabitans suffuscus: Psuf_034910
Entry
Psuf_034910       CDS       T06545                                 
Symbol
adk_1
Name
(GenBank) adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
psuu  Phytohabitans suffuscus
Pathway
psuu00230  Purine metabolism
psuu00730  Thiamine metabolism
psuu01100  Metabolic pathways
psuu01110  Biosynthesis of secondary metabolites
psuu01232  Nucleotide metabolism
psuu01240  Biosynthesis of cofactors
Module
psuu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:psuu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Psuf_034910 (adk_1)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Psuf_034910 (adk_1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psuu04147]
    Psuf_034910 (adk_1)
Enzymes [BR:psuu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     Psuf_034910 (adk_1)
Exosome [BR:psuu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psuf_034910 (adk_1)
SSDB
Motif
Pfam: ADK AAA_17 ADK_lid AAA_18 Thymidylate_kin AAA_33
Other DBs
NCBI-ProteinID: BCB86178
UniProt: A0A6F8YJP0
LinkDB
Position
3806113..3806754
AA seq 213 aa
MHLMRKYVVMGVQGSGKGTQAQLLCEEYDLVHINVGDIFRWHVQHHTKLGAQVRRTMASG
ELIGDDQVETVVKDRLHQHDWNYGFVIDGFPRNGRQAEFFLETFDIDGVIHLELPDEEVH
RRVLNRRLCSRCGMDYNLIADRPEEEGKCDVCGGELVTRADDTPEALAARLREYHTKTKP
VLDIFRRKEYVVTIDARPDQATVQRDIRQKLGL
NT seq 642 nt   +upstreamnt  +downstreamnt
gtgcacctcatgcgcaagtacgtcgtgatgggcgtgcagggcagcggcaagggcacccag
gcccagctgctctgcgaggagtacgacctcgtgcacatcaacgtcggcgacatcttccgc
tggcacgtgcagcaccacaccaagctcggtgcccaggtgcggcgcacgatggcgtccggc
gagctgatcggcgacgaccaggtggagacggtagtcaaggaccgcctccaccagcacgac
tggaactacggcttcgtcatcgacggctttccgcgcaacgggcggcaggcggagttcttc
ctggagaccttcgacatcgacggtgtcatccacctcgaactgccggacgaggaggtgcac
cgccgcgtgctcaaccggaggctctgctcccgctgcggcatggactacaacctcatcgcc
gaccggccggaggaggagggcaagtgcgacgtctgcggtggggaactggtcacccgcgcc
gacgacacgcccgaggcgctggcggcacggctgcgggagtaccacaccaagaccaagccg
gtgctcgacatctttcgccgcaaggagtatgtcgtgaccatcgacgcccgccccgaccag
gccaccgtgcagcgcgacatccggcagaagctcggcctgtga

DBGET integrated database retrieval system