Phytohabitans suffuscus: Psuf_037040
Help
Entry
Psuf_037040 CDS
T06545
Symbol
nuoJ
Name
(GenBank) NADH:ubiquinone oxidoreductase subunit J
KO
K00339
NADH-quinone oxidoreductase subunit J [EC:
7.1.1.2
]
Organism
psuu
Phytohabitans suffuscus
Pathway
psuu00190
Oxidative phosphorylation
psuu01100
Metabolic pathways
Module
psuu_M00144
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:
psuu00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
Psuf_037040 (nuoJ)
Enzymes [BR:
psuu01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
Psuf_037040 (nuoJ)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Oxidored_q3
MbhD
Motif
Other DBs
NCBI-ProteinID:
BCB86391
UniProt:
A0A6F8YKB1
LinkDB
All DBs
Position
4025370..4026131
Genome browser
AA seq
253 aa
AA seq
DB search
MSGVAAAGGMSTGEAVTFWILVWPALIGALGMVFSRNAIHSALWLVMTMLCLGVFYVLQS
APFIGVAQIIVYTGAIMMLFLFVLMLVGRDASDSLIETLRGQRLAAVVLGIGFAALVGTG
VYRALEDTPAVGLDQANANGNVQGIAALLFTKYVFAFEVTSALLITAAIGAMVLAHIERR
RGEKRSQPELMRARFAPGNYPGPKPGPGVYATSDSVATPGRLPDGTLTERSISQILPARE
LTPAESAPKGTEK
NT seq
762 nt
NT seq
+upstream
nt +downstream
nt
gtgagcggcgtcgcggccgccggcgggatgtccaccggcgaggcggtcaccttctggatc
ctggtgtggccggccctgatcggcgcgctcggcatggtcttctcccgcaacgcgatccac
tccgcgctgtggctggtgatgaccatgctctgcctcggcgtgttctacgtgctgcagtcg
gcgccgttcatcggcgtcgcgcagatcatcgtgtacaccggcgcgatcatgatgctcttc
ctattcgtgctgatgctggtcggccgggacgcctccgactcgctgatagagacgttgcgc
gggcagcggctcgcggcggtcgtgctcggcatcggcttcgccgcgctggtcggcaccggc
gtctaccgggcgctggaggacaccccggcggtcggcctcgatcaggcgaacgcgaacggc
aacgtccagggcatcgcggcgctgctgttcaccaagtacgtcttcgccttcgaggtcacg
tcagcgctgctgatcacggcggccatcggcgcgatggtgctggctcacatcgagcggcgg
cgcggcgagaagcgcagccagccggagttgatgcgggcgcggttcgctccgggcaactac
cccggcccgaagcccggccccggcgtgtacgccacgtccgactcggtcgccactcccggc
cgcctgccggacggcacgctgaccgagcggagcatctcccagatcctgcctgcccgcgag
ctgactccggcggaatcggcaccgaagggtaccgagaagtga
DBGET
integrated database retrieval system