Phytohabitans suffuscus: Psuf_068130 Help Entry Psuf_068130       CDS       T06545                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism psuu  Phytohabitans suffuscus Pathway psuu00362   Benzoate degradation psuu00621   Dioxin degradation psuu00622   Xylene degradation psuu01100   Metabolic pathways psuu01120   Microbial metabolism in diverse environments psuu01220   Degradation of aromatic compounds Module psuu_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:psuu00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     Psuf_068130    00622 Xylene degradation     Psuf_068130    00621 Dioxin degradation     Psuf_068130 Enzymes [BR:psuu01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      Psuf_068130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Poly_export Motif Other DBs NCBI-ProteinID:  BCB89500 UniProt:  A0A6F8YTM4 LinkDB All DBs Position complement(7315062..7315262) Genome browser AA seq 66 aa AA seqDB search MPLVEVTLVEGRTPAQLRALITALTDAVEAAVEAPRDSIRVVLREVPATHWAAGDVTIAE RRRDRP NT seq 201 nt NT seq  +upstreamnt  +downstreamnt gtgccgctggtcgaggtgaccctggtcgaggggcgcacgcccgcgcagctgcgcgcgctc atcaccgcgctcaccgacgcggtcgaggcggcggtcgaggcgccgcgcgacagcatccgc gtcgtgctccgcgaggtcccggccacccactgggcggccggcgacgtgacgatcgccgaa cgcaggagggaccgaccgtga

DBGET integrated database retrieval system