Phytohabitans suffuscus: Psuf_087200 Help Entry Psuf_087200       CDS       T06545                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism psuu  Phytohabitans suffuscus Pathway psuu03060   Protein export psuu03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:psuu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     Psuf_087200  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     Psuf_087200  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:psuu02044]     Psuf_087200 Secretion system [BR:psuu02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    Psuf_087200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF6541 Motif Other DBs NCBI-ProteinID:  BCB91407 UniProt:  A0A6F8YZ37 LinkDB All DBs Position complement(9364210..9364488) Genome browser AA seq 92 aa AA seqDB search MGALKPWHIAVLVVVLVLLFGAKRLPDAARSLGRSLRIIKAETKHLTDDDERDLAEKADA QHGRQPLPPTATEQRPATPVQDPVQRSTRDIS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgggcgccctcaagccgtggcacatcgcagtcctcgtggtcgtgctggtcctcctgttc ggcgcgaagcggttgcctgacgcagcccggtcgctgggccgctcgttgcggatcatcaag gccgagaccaagcacctgaccgacgacgacgagcgcgacctcgccgaaaaggcggacgcc cagcacggtcgccagccgctcccgccgacggcgaccgagcagcgtccggccacgccggtc caggatccggtgcagcgcagcacgcgcgacatttcctga

DBGET integrated database retrieval system