Pseudoxanthomonas suwonensis J1: WQ53_09015
Help
Entry
WQ53_09015 CDS
T04241
Name
(GenBank) hypothetical protein
Organism
psuw
Pseudoxanthomonas suwonensis J1
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ChitinaseA_N
fn3
Motif
Other DBs
NCBI-ProteinID:
AKC86872
UniProt:
A0A0E3Z1S3
LinkDB
All DBs
Position
2156998..2159325
Genome browser
AA seq
775 aa
AA seq
DB search
MLAIRDGRSLYSVYGQDGVLRFQRDERTGKTTDYVHLAGSLVAQVENAIPLSTPTLTAPS
SNTTGNYTVSWTAVPVASKYQLQERLNSGSWTTIHDAGGVGKDLSGKAAGVWGYQVRACS
ETTCGSWSAEKAVTVQLPPTGVPTLTAPASSTTGSYTVSWTTVAAATTYELQESVNGGGY
TTIQNSASTSLNATGRQSGNWSYQVRACNAVGCAAWSAAKVTQVTLPPSAVPVLTAPANN
YTGSYTVSWNSVTAATRYELEERLGAGGWTLVHDAAGTSKAVSGKTAGSWGYRARGCNVN
ACGDWSAIVAVVVTLPPASVPALTVPATDNTGSYSVSWTSVATATSYELQERLNAGSWST
IQNTSATSKAISGKTTGSWGYQVRACNAGGCSAYSAVGTVAVTLPPQAAPTLTVPAIAIN
GNFIVSWTSVAAAASYQLQERQGMGSWSTVHDAAGTSTAVSGKTAGAWSYQVRACNGGGC
AAWSTVQTVNALYAPASAPTLSVPSSNYTGSYTVSWTSVGTADRYELQEQPPTGGWNTIH
DAAGTSTAVSGKTAGAWSYRVQACNAAGCSGWSGTSATAVTLPPASAPALTTPAANGTGN
YTVSWTAVAAATRYELDQRKDGGAWSNIHNEAATSKALSGQATGIYDYRVRACNEGGCGA
YSAVGSTQVILPPAGAPSLNATMPDFSGVFTLSWSTVSGATSYRLEENVAGWNVIHESAG
TSLMVMRSPGSYLYRVQACNAGGCGGHSATQLVMVQAACPECHPDSVPAPPEEEL
NT seq
2328 nt
NT seq
+upstream
nt +downstream
nt
gtgctggcgatccgtgacggccggagcctgtattcggtctacgggcaggatggcgtcctg
cgcttccagcgagacgagcgcactggcaagacgaccgactacgtgcatctggctggcagc
ctggtggcgcaggtggagaatgcgatccccttgtccacgccgacgctgaccgcgccaagc
tcgaacacgacgggcaactacaccgtcagctggacggccgtgccggtggcatcgaaatac
cagctgcaggagcggctaaacagcggcagttggaccacgatccatgatgcgggtggagtc
ggcaaggacctgagcggcaaggcggcaggggtgtggggataccaggtcagggcctgtagc
gaaaccacgtgcggcagttggagcgcggaaaaggcggtaaccgtgcaactgccgcccacc
ggcgtgccgaccttgacagccccggcttccagcacgaccggcagctataccgtcagttgg
acgacggtggcggcggcgaccacctatgaactgcaggagagtgtcaacggcgggggctac
accacgatccagaacagcgccagcaccagtctcaacgccactggacgccagagcggcaac
tggagctatcaggttcgggcctgcaatgccgtcggatgcgcggcctggtcggcggcgaag
gtgacgcaggtgaccctgccaccgtcggccgtgccagtgctgacggccccggccaacaac
tacaccggcagctacacggtcagctggaacagcgtcactgccgccacccgctatgaactc
gaggagcggttgggcgccggtggttggacccttgtccatgatgcggctggaaccagcaag
gcagtcagtggaaagacggccggcagctggggctaccgcgcgcgtggatgcaacgtcaat
gcctgcggcgactggagtgcgatcgtggcggtggtggtgaccctgccgccggcctcggtg
ccggcattgaccgtcccggcgacggacaataccggtagctacagtgtgagctggacgtcg
gtggcgaccgccacaagctacgaactgcaggagcgcctgaacgcgggcagctggagcacg
atccagaacacttccgcgacgagcaaggcaatcagtggcaagaccacgggaagctggggt
taccaggtccgggcctgcaacgcggggggatgctccgcgtactcggctgtcgggacggtg
gcggtcaccctgccgccgcaggccgcgccaacgttgacggtcccggccatcgcgatcaac
ggcaacttcatcgtcagctggaccagcgtggccgcagctgcgagctaccagttgcaggaa
cgccaggggatggggagttggagcacggtgcacgacgcggccgggaccagcacagcggtc
agcggcaagaccgccggagcctggagctaccaggtgcgggcctgcaatgggggcggctgt
gcggcctggtcgacggtccagacggtcaacgcgctctatgcgcctgccagcgcaccgaca
ctgagcgtgccatccagcaactacaccggcagctacaccgtcagttggacgagcgtgggc
acggccgaccggtacgagctgcaggagcagccgcccaccggcggttggaacacgatccac
gacgcggccgggaccagcacggcggtcagcggcaagaccgccggagcctggagctaccgc
gtgcaggcatgcaacgcggctggctgcagtggctggtcgggcaccagcgccacggctgtg
accttgccgccggcctcggcgcctgcgctgaccaccccggccgccaacggtaccggcaac
tacacggtcagctggacggccgtggcggctgccacgcgctatgaactggatcagcgcaag
gatggtggcgcctggagcaacatccacaatgaggccgcgacgagcaaggcgctgtcggga
caggccacagggatctacgactatcgggtccgggcttgcaacgagggtggatgcggggcg
tactcggcggtcggcagcacgcaagtgatcctgccgccggcgggggcgccgtcgctgaac
gccacgatgccggacttctcgggggtgttcacgctgagctggagcacggtgagtggagcg
accagctaccggttggaggagaacgtggccggctggaacgtgatccatgagtcggcgggc
acgagcctgatggtgatgcggtcgccgggcagttatctgtaccgggtgcaggcgtgcaat
gcgggtggttgcggggggcattcggcgacccagctggtgatggtgcaggcggcatgtccg
gagtgccatccggattcggtcccggcgccgccggaggaggagctatga
DBGET
integrated database retrieval system