Pseudoxanthomonas suwonensis J1: WQ53_09340 Help Entry WQ53_09340        CDS       T04241                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psuw  Pseudoxanthomonas suwonensis J1 Pathway psuw01100   Metabolic pathways psuw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psuw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WQ53_09340    00074 Mycolic acid biosynthesis     WQ53_09340   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WQ53_09340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKC86926 UniProt:  A0A0E3UN66 LinkDB All DBs Position 2245095..2245364 Genome browser AA seq 89 aa AA seqDB search MSQQTDAERELAELLVESLNLEGVEPHAIDPEAPLFNEGLGLDSIDALELSLAVAKRYGV QLRAEGEDNRRIFASLRALSAHVQSQRGG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcgcagcagaccgatgccgaacgcgaactggccgaactcctggtcgagagcctgaac ctggagggcgtggaaccgcacgcgatcgacccggaggcgccgctgttcaacgagggcctg ggcctggattcgatcgacgcgctggagctgtcgctggcggtggccaagcgctacggcgtg cagctgcgcgcggagggcgaggacaaccgccgcatcttcgcctcgctgcgtgcgttgtcg gcgcatgtccagtcgcaacgcggtggctga

DBGET integrated database retrieval system