Pseudoxanthomonas suwonensis J1: WQ53_12385 Help Entry WQ53_12385        CDS       T04241                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism psuw  Pseudoxanthomonas suwonensis J1 Pathway psuw02024   Quorum sensing psuw03018   RNA degradation Brite KEGG Orthology (KO) [BR:psuw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     WQ53_12385  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     WQ53_12385  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:psuw03019]     WQ53_12385    03036 Chromosome and associated proteins [BR:psuw03036]     WQ53_12385 Messenger RNA biogenesis [BR:psuw03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      WQ53_12385 Chromosome and associated proteins [BR:psuw03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     WQ53_12385 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AKC87430 UniProt:  A0A0E3UP14 LinkDB All DBs Position 2987306..2987581 Genome browser AA seq 91 aa AA seqDB search MSKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRSTVSQMVYKHAIS TVVPSRNVRVGPGGGYVQQPGESGEGGDEAE NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgtccaagggacaatcgctgcaggatcctttcctgaacgcactgcgccgcgaacgcgtg ccggtgtcggtctacctggtgaacggcatcaagttgcagggtacgatcgaatccttcgac cagttcgtggtgctgctgcgcagcaccgtcagccagatggtctacaagcacgccatttcc accgtcgtgccgtcgcgcaatgtccgggtcggcccgggcggcggctacgtgcagcagccg ggcgaatccggggaaggcggcgacgaggccgagtga

DBGET integrated database retrieval system