Pseudomonas sp. VLB120: PVLB_01800 Help Entry PVLB_01800        CDS       T02897                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psv  Pseudomonas sp. VLB120 Pathway psv01100   Metabolic pathways psv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PVLB_01800    00074 Mycolic acid biosynthesis     PVLB_01800   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PVLB_01800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGZ33169 UniProt:  A0AAN0V877 LinkDB All DBs Position complement(408063..408335) Genome browser AA seq 90 aa AA seqDB search MSDPQHDLHRDLKQLIIDALGLEDIGVQDIDDQQPLFGEGLGLDSVDALELGLALQKRYG FKIDADAKDTRNHFRNVATLAAFVTARKAA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgagcgatccacaacacgacctgcaccgtgacctcaagcaactgatcatcgacgccctc ggccttgaagatatcggcgtgcaggacatcgacgaccagcaaccgctgtttggcgaaggc ctgggcctggactcggtggatgcactggaattgggcctggcactgcagaagcgctatggc ttcaagatcgacgccgatgccaaggacacccgcaaccatttccgtaacgtcgccaccttg gccgcgttcgtcactgcccgtaaggctgcctga

DBGET integrated database retrieval system