Pseudomonas sp. VLB120: PVLB_04625 Help Entry PVLB_04625        CDS       T02897                                  Symbol groES Name (GenBank) co-chaperonin GroES   KO K04078   chaperonin GroES Organism psv  Pseudomonas sp. VLB120 Brite KEGG Orthology (KO) [BR:psv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:psv03110]     PVLB_04625 (groES)    03029 Mitochondrial biogenesis [BR:psv03029]     PVLB_04625 (groES) Chaperones and folding catalysts [BR:psv03110]  Heat shock proteins   HSP10    PVLB_04625 (groES) Mitochondrial biogenesis [BR:psv03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     PVLB_04625 (groES) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  AGZ33732 LinkDB All DBs Position 1052417..1052710 Genome browser AA seq 97 aa AA seqDB search MKLRPLHDRVVIRRSEEESKTAGGIVLPGSAAEKPNRGEVVAVGTGRILDNGEVRALAVK VGDKVVFGPYSGSNTVKVDGEDLLVMSENEILAVVEG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaagcttcgtcctctgcatgaccgcgtagtcatccgtcgcagcgaagaagaatcgaaa accgctggcggtatcgtcctgccgggttcggccgctgaaaaaccaaaccgcggcgaagtt gtcgccgtgggcaccggtcgcatcctggacaacggcgaagtacgtgcactggccgtcaaa gtgggtgacaaagtggttttcggcccttactcgggcagcaacaccgtgaaagtcgatggc gaagacctgctggtgatgagcgagaacgaaatcctcgccgtcgttgaaggctaa

DBGET integrated database retrieval system