Pseudomonas sp. VLB120: PVLB_12320 Help Entry PVLB_12320        CDS       T02897                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism psv  Pseudomonas sp. VLB120 Pathway psv01100   Metabolic pathways psv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PVLB_12320    00074 Mycolic acid biosynthesis     PVLB_12320   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PVLB_12320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGZ35252 UniProt:  A0AAN0VA73 LinkDB All DBs Position 2721531..2721815 Genome browser AA seq 94 aa AA seqDB search MTHHTHEHRIRQALAQLLGPEVELIGMRDSFREFLGERFDSLMAVEVVTVIEATFGFEVD YLSDDIRFWFETLEKMDQFIGQKLEDQLTLQAVQ NT seq 285 nt NT seq  +upstreamnt  +downstreamnt gtgacacaccacacccatgaacaccgcattcgccaggcccttgcgcaattgctcggcccg gaagtcgaactgatcggtatgcgcgatagcttccgcgagtttctcggcgagcgtttcgac agcctgatggcggtcgaggtcgttaccgtcatcgaggctacctttggcttcgaagtggat tacctcagcgacgatattcgcttctggttcgaaaccctggaaaagatggaccagttcatc ggccagaaactcgaagaccagttgaccttgcaggccgtccaatga

DBGET integrated database retrieval system