Pseudomonas sp. VLB120: PVLB_19380 Help Entry PVLB_19380        CDS       T02897                                  Name (GenBank) septum formation initiator   KO K05589   cell division protein FtsB Organism psv  Pseudomonas sp. VLB120 Brite KEGG Orthology (KO) [BR:psv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:psv03036]     PVLB_19380 Chromosome and associated proteins [BR:psv03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PVLB_19380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC NRBF2 ACCA_BT YabA Motif Other DBs NCBI-ProteinID:  AGZ36657 UniProt:  A0AAN0R5C0 LinkDB All DBs Position complement(4259318..4259599) Genome browser AA seq 93 aa AA seqDB search MRSPYWLFLVLLLLLGGLQYRLWVGNGSLAQVAELKQQIAEQHAENERLLERNRVLDAEV LELKKGMETVEERARHELGMVKEGETLFQLPQK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtccctattggttgttccttgtcctgctcctgctgctcggtggcctgcagtac cgcctgtgggtgggtaatggcagcctggcgcaagtggccgagctcaagcagcagattgcc gagcagcatgcggagaacgagcgtttgctcgagcgtaaccgtgtgcttgacgcggaggtc ctggagttgaagaaaggtatggagaccgtcgaagaacgggctcgtcatgaattgggaatg gtcaaagagggcgaaactctcttccagttgccgcaaaaatga

DBGET integrated database retrieval system