Pseudomonas sp. VLB120: PVLB_24700 Help Entry PVLB_24700        CDS       T02897                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism psv  Pseudomonas sp. VLB120 Brite KEGG Orthology (KO) [BR:psv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:psv03036]     PVLB_24700 Chromosome and associated proteins [BR:psv03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PVLB_24700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Filament ADIP Asd-4 TPR_MLP1_2 ZapB Motif Other DBs NCBI-ProteinID:  AGZ37719 UniProt:  A0AAN0R783 LinkDB All DBs Position 5424037..5424246 Genome browser AA seq 69 aa AA seqDB search MQEKDLQALMSRFELLIERVEQLKRQNALLIAQEKSWREERAHLIEKNEIAKRKIESMIL RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgcaagagaaagacctgcaagcgctgatgagccggttcgagttgctgatcgaacgtgtc gagcaacttaaacggcaaaatgcactcctaattgctcaggaaaaatcctggcgcgaggaa cgcgcccacctcatcgaaaagaacgaaatcgccaagcgcaagatcgagtcgatgatttta cgcctgaaggccctggagcaagactcatga

DBGET integrated database retrieval system