Pseudomonas cremoricolorata: LK03_07225 Help Entry LK03_07225        CDS       T03354                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psw  Pseudomonas cremoricolorata Pathway psw01100   Metabolic pathways psw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LK03_07225    00074 Mycolic acid biosynthesis     LK03_07225   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LK03_07225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  AIR89074 UniProt:  A0A089WPJ6 LinkDB All DBs Position complement(1662174..1662428) Genome browser AA seq 84 aa AA seqDB search MQTREDIFNILRDALVELFELDPARISLDSNLYQDLEIDSIDAVDLIDHIKRQTGKKIAA DEFKSVRTVNDVVEAVYRLVNSPA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaacccgtgaagacatcttcaacatcctgcgcgacgccctggtcgagctgttcgaa ctggacccggcgcgtatcagcctggactcgaacctgtaccaggacctggaaatcgacagc atcgacgccgtcgacctgatcgaccacatcaagcgccagaccggcaagaaaatcgccgct gatgagttcaagtcggtgcgtaccgtcaacgacgtggtcgaggcggtgtaccgcctggtc aactcgccggcatga

DBGET integrated database retrieval system