Pseudomonas cremoricolorata: LK03_07310 Help Entry LK03_07310        CDS       T03354                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism psw  Pseudomonas cremoricolorata Brite KEGG Orthology (KO) [BR:psw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:psw03110]     LK03_07310 Chaperones and folding catalysts [BR:psw03110]  Protein folding catalysts   Protein disulfide isomerase    LK03_07310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Thioredoxin_2 Glrx-like GST_N SH3BGR CLIC-like_N DSBA Motif Other DBs NCBI-ProteinID:  AIR89091 UniProt:  A0A089WKG5 LinkDB All DBs Position 1684452..1684706 Genome browser AA seq 84 aa AA seqDB search MKSVIVYSSDYCPYCIRAKQLLNSKGVDFEEIKVDGKPQVRAQMSQKAGRTSVPQIWIGS THVGGCDELFALERAGKLDPLLQS NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaagagcgtcatcgtctactccagcgactattgcccctactgcatccgcgccaagcaa ctgctcaacagcaaaggtgttgacttcgaggaaatcaaggtcgacggcaagccgcaagtg cgcgcgcaaatgagccagaaggcgggccgcacctcggtgccgcagatctggatcggcagt acccacgtcggcggctgcgatgagctcttcgccctggagcgggcgggcaaactcgacccg ctgctgcagtcctga

DBGET integrated database retrieval system