Pseudomonas cremoricolorata: LK03_11030 Help Entry LK03_11030        CDS       T03354                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism psw  Pseudomonas cremoricolorata Brite KEGG Orthology (KO) [BR:psw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:psw03036]     LK03_11030 Chromosome and associated proteins [BR:psw03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     LK03_11030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC NRBF2 ACCA_BT HALZ YabA Motif Other DBs NCBI-ProteinID:  AIR89793 UniProt:  A0A089YDF0 LinkDB All DBs Position 2508334..2508615 Genome browser AA seq 93 aa AA seqDB search MRSPYWLFLVLLLLLAGLQYRLWVGNGSLAQVAELKQQIDDQHAENERLLERNRVLDAEV LELKKGMETVEERARHELGMVKEGETLYQLPQK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtccttactggttgttcctcgttctgctcctgctgctggccggcctgcagtac cgcctgtgggtaggcaacggcagccttgcccaggtcgccgagctcaagcagcagatcgac gaccagcacgccgagaacgagcggctgctcgagcgaaaccgcgtcctggacgctgaggtg ctggaactgaaaaagggcatggagaccgtcgaagagcgggctcggcatgagctggggatg gtcaaggagggtgagaccctctaccagttgccgcagaaatga

DBGET integrated database retrieval system