KEGG   Pseudoliparis swirei (Mariana hadal snailfish): 130199281
Entry
130199281         CDS       T09868                                 
Name
(RefSeq) solute carrier family 25 member 45
  KO
K15123  solute carrier family 25, member 45/47
Organism
pswi  Pseudoliparis swirei (Mariana hadal snailfish)
Brite
KEGG Orthology (KO) [BR:pswi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pswi02000]
    130199281
Transporters [BR:pswi02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   130199281
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 130199281
NCBI-ProteinID: XP_056278602
LinkDB
Position
9:complement(4583062..4588655)
AA seq 285 aa
MPSMEFIAGSLSGALGLAVGYPLDTVKVRLQAHSAYQGILHCMSKTYSNEGLRGFFKGMA
FPVLTAGINNAVIFGSYSNALDYLTESRHAARDRGKAASAAQVFAAGCFSGMMQVCVYAP
IDLVKVRLQGQTTVQRYRGPVHCIAVILRKEGPKGLFRGGLAIALRDIPFYGLYFLPYEV
TRKALTQSGKEPGTFAIMMAGGVAGVVTWAFATPMDVVKVRLQMSGVEGRVYRGVLHCMS
VSFREEGARVFFKGLLLNCLRAFPVNAVTFLSYESLMRMFCPPTR
NT seq 858 nt   +upstreamnt  +downstreamnt
atgccttctatggaattcatagccgggagtctttccggtgcactgggactggcagtcgga
tatccattagacaccgtgaaggtgcgcctgcaggcccattctgcttatcaaggaatactt
cactgtatgtctaaaacatactccaacgaagggctccggggattcttcaaaggcatggca
ttcccagtgctgaccgctggcatcaacaacgctgtcatctttggctcttacagtaacgcc
ttggattacctcactgagtctcggcacgcggcccgcgatcggggcaaagcggcctccgct
gcgcaggtgttcgccgccggctgtttctcaggcatgatgcaggtgtgtgtttacgcgccc
attgacctggtgaaggtgcgtcttcagggtcagacgaccgttcagagataccgtgggccc
gttcattgcatcgccgtcatcctgaggaaggaggggcctaagggtctgttcagggggggg
ctggccatcgccctgagggacatacccttctacggactttacttcttgccctacgaagtc
acccgaaaggccctgacccagagcggcaaagagccagggacgttcgcaataatgatggca
ggcggcgtggcgggcgtggtgacctgggccttcgccacgcccatggacgtggtgaaagtc
cggctccagatgtcgggggtcgaaggccgggtgtaccgaggggtcctgcactgcatgagc
gtgagcttcagggaggagggagcgagggtcttcttcaaaggcctcctgctgaactgcctg
agggctttccccgtcaacgccgtcacgttcctcagctacgagagtctgatgaggatgttc
tgcccgccgaccaggtga

DBGET integrated database retrieval system