Pseudomonas sp. W03: SD196_20465 Help Entry SD196_20465       CDS       T11012                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism pswo  Pseudomonas sp. W03 Brite KEGG Orthology (KO) [BR:pswo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pswo03036]     SD196_20465 (ftsB) Chromosome and associated proteins [BR:pswo03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     SD196_20465 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC Mod_r NRBF2 GP57 YabA SlyX Motif Other DBs NCBI-ProteinID:  XOT21291 LinkDB All DBs Position complement(4483749..4484033) Genome browser AA seq 94 aa AA seqDB search MRLRSPYWLFVVLILALAGLQYRLWVGDGSLAQVRDLQKQIADQQGENERLLERNRILEA EVAELKKGTETVEERARHELGMVKDKETLYQLAQ NT seq 285 nt NT seq  +upstreamnt  +downstreamnt ttgaggttacgtagcccttattggctgttcgtcgtgctgattctggcgctggccggcttg cagtatcgcctgtgggtaggtgatggcagcctggcgcaggtgcgcgacctgcaaaagcag atcgccgaccagcagggcgagaacgagcgcctgctcgaacgtaaccgcatcctcgaggcc gaagtggccgagctcaagaaaggcaccgagacggtcgaggaacgtgcccgccacgagctc ggcatggtcaaggacaaggaaaccctctaccagctcgcgcaatga

DBGET integrated database retrieval system