Paenibacillus swuensis: SY83_13050 Help Entry SY83_13050        CDS       T04884                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism pswu  Paenibacillus swuensis Pathway pswu03060   Protein export pswu03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:pswu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SY83_13050  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     SY83_13050  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pswu02044]     SY83_13050 Secretion system [BR:pswu02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    SY83_13050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ANE47042 UniProt:  A0A172TJA2 LinkDB All DBs Position 2960075..2960323 Genome browser AA seq 82 aa AA seqDB search MGLNSIGPTGFILLVVIALLLFGPNKLPELGRAFGRTLREFKQGAKDMMSDDDDKPRRQD ITPGDAGRLDAERKDDNRRLPE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgggtttaaacagtatcggacctacgggttttattctattagtagttattgcattactg ttgttcggaccgaataagttgcctgagctgggacgcgcattcggaagaacgttgcgtgaa tttaagcaaggggccaaagatatgatgtctgacgatgatgataagccgcgccgtcaggat attacacccggagatgccgggaggctcgatgccgaacgtaaagacgacaaccgccggttg cctgaataa

DBGET integrated database retrieval system