Pseudochrobactrum sp. XF203: LDL70_05580
Help
Entry
LDL70_05580 CDS
T10521
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
psxf Pseudochrobactrum sp. XF203
Pathway
psxf00770
Pantothenate and CoA biosynthesis
psxf01100
Metabolic pathways
psxf01240
Biosynthesis of cofactors
Module
psxf_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
psxf00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
LDL70_05580 (coaD)
Enzymes [BR:
psxf01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
LDL70_05580 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Motif
Other DBs
NCBI-ProteinID:
UCA46694
LinkDB
All DBs
Position
1259749..1260243
Genome browser
AA seq
164 aa
AA seq
DB search
MKTALYAGSFDPVTNGHLDVLRGALGLADKVIVAIGVHPGKAPMFSFEERVELLREAGEQ
AFGKDNSRIDYTSFSGLVVDTARSFNATLMVRGLRDATDFDYEMQMAGMNAGLAADVQTV
FLPASPDVRFITATLVRQIAAMGGDVSRFVPPVIEKALKHKLKK
NT seq
495 nt
NT seq
+upstream
nt +downstream
nt
atgaaaacagctctctatgcaggatcatttgatccggtcaccaatggtcatcttgatgtt
ctgcgcggggctctcgggctggctgacaaggtgattgttgctatcggcgtccatccgggc
aaagccccgatgttcagctttgaagagcgggttgagctgctgcgcgaagccggagagcag
gctttcggcaaagataatagccgtattgattataccagtttcagcggtctggtggtggac
actgccagaagtttcaatgcaacactgatggtgcgcggtttacgcgatgccactgatttt
gattatgaaatgcagatggccggtatgaatgcggggctggcagcggatgtgcagactgtg
tttttgcccgcttcccccgatgtgcgttttattactgccacactggtgcgccagattgcg
gcaatggggggcgatgtcagccgcttcgtgccgcctgttatcgaaaaagccctaaagcat
aagcttaaaaaataa
DBGET
integrated database retrieval system