Pseudochrobactrum sp. XF203: LDL70_11810 Help Entry LDL70_11810       CDS       T10521                                  Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism psxf  Pseudochrobactrum sp. XF203 Pathway psxf00260   Glycine, serine and threonine metabolism psxf01100   Metabolic pathways Module psxf_M00975   Betaine degradation, bacteria, betaine => pyruvate Brite KEGG Orthology (KO) [BR:psxf00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     LDL70_11810 Enzymes [BR:psxf01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      LDL70_11810     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      LDL70_11810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Zn_ribbon_3 Motif Other DBs NCBI-ProteinID:  UCA45026 LinkDB All DBs Position 2605524..2605850 Genome browser AA seq 108 aa AA seqDB search MLLIHCPYCGEDRSELEFRSAHDAHIARPTNITELSDEEFVEFLYWRDNPKGVIFERWRH IHGCGRFFNAARDTVSDKFLLTYKAGEPKPDLSQIVQTNSVAAKESGK NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgcttttgatccattgcccttattgcggcgaagaccgctcggagctggaattccgcagc gctcatgatgctcatattgcccgcccgaccaatataaccgaactttcggacgaggaattc gttgagtttctctattggcgcgacaatcccaaaggcgtaatttttgaacgctggcggcat attcacggctgcggccgcttcttcaacgcggcacgcgatacggtgagcgacaagttcctg ctcacctataaagccggagagccgaaaccggatctgagccaaatcgtacagacgaacagt gttgcggccaaggagagtggtaaatga

DBGET integrated database retrieval system