Psychrobacter sp. AntiMn-1: AOT82_156 Help Entry AOT82_156         CDS       T04964                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism psya  Psychrobacter sp. AntiMn-1 Pathway psya03430   Mismatch repair Brite KEGG Orthology (KO) [BR:psya00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     AOT82_156  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:psya03400]     AOT82_156 Enzymes [BR:psya01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      AOT82_156 DNA repair and recombination proteins [BR:psya03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      AOT82_156 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S FliD_N TBCA Apo-CII Motif Other DBs NCBI-ProteinID:  AOY42535 UniProt:  A0A1D9CVF1 LinkDB All DBs Position complement(184608..184853) Genome browser AA seq 81 aa AA seqDB search MTTPTRRRKKAAPKTFKAAYDILKTNAAELQQQDEPDIDNLMTTVEESIAAYRVCETRIN AVQQALDAAFAEEKSTSSTDS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaccacccctactcgcagacgcaaaaaagccgccccaaaaacctttaaggcggcttac gatattttaaaaaccaatgcggccgaattacagcaacaagacgagcctgatattgataat ctgatgaccacggttgaagagtctattgcggcttatcgcgtttgcgaaacccgtattaac gcggtacagcaagcattggatgcggccttcgccgaagaaaaatctactagcagcacggac agttag

DBGET integrated database retrieval system