Desulfovibrio mangrovi: N1030_12275 Help Entry N1030_12275       CDS       T08614                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism psyf  Desulfovibrio mangrovi Pathway psyf00020   Citrate cycle (TCA cycle) psyf00720   Other carbon fixation pathways psyf01100   Metabolic pathways psyf01110   Biosynthesis of secondary metabolites psyf01120   Microbial metabolism in diverse environments psyf01200   Carbon metabolism psyf01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:psyf00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     N1030_12275   09102 Energy metabolism    00720 Other carbon fixation pathways     N1030_12275 Enzymes [BR:psyf01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      N1030_12275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4_6 Fer4 Fer4_2 Fer4_10 Fer4_21 Fer4_9 Fer4_8 Fer4_4 Fer4_16 Fer4_3 Fer4_15 Fer4_13 Fer4_17 Fer4_22 Fer4_18 Motif Other DBs NCBI-ProteinID:  UZP66382 LinkDB All DBs Position 2716871..2717098 Genome browser AA seq 75 aa AA seqDB search MARVEFRDERCKGCLLCTTVCPKEIICQSARFNKQGYKVAEVKEEDMEKCTGCASCALIC PDLAIKVYREKKEKK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcacgggtagaatttagggacgagaggtgcaaaggatgccttctctgtacgaccgta tgccccaaggagatcatctgccagtcagcccgcttcaacaagcagggctacaaggtggca gaggtcaaggaagaggacatggaaaaatgcacgggctgtgcgtcttgtgcattgatatgc cctgatcttgcgatcaaagtgtaccgcgagaagaaggagaagaagtag

DBGET integrated database retrieval system