KEGG   Psychrobacter sp. P11G5: AK825_02230
Entry
AK825_02230       CDS       T04411                                 
Name
(GenBank) response regulator receiver protein
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
psyg  Psychrobacter sp. P11G5
Pathway
psyg02020  Two-component system
psyg02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:psyg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AK825_02230
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    AK825_02230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:psyg02022]
    AK825_02230
   02035 Bacterial motility proteins [BR:psyg02035]
    AK825_02230
Two-component system [BR:psyg02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   AK825_02230
Bacterial motility proteins [BR:psyg02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AK825_02230
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-ProteinID: AMN66686
LinkDB
Position
537773..538135
AA seq 120 aa
MYKLMIVDDSNIIRNRIQRAYDSGNFMLVATATSGVQAIEKFNMHRPDVITMDLTMPQMD
GLECIEKIIAIDPDVRILVVSALSDKSTGIEALSLGASGFLCKPFSEEDLVESLYELMQD
NT seq 363 nt   +upstreamnt  +downstreamnt
atgtataaactaatgattgttgatgattccaatattatccggaaccggattcagcgggct
tatgactcaggaaatttcatgttggttgctacagcaaccagtggtgttcaagccattgaa
aaattcaatatgcatcgcccagatgtcatcacgatggatctaaccatgccgcaaatggat
ggtcttgaatgtatcgagaagattattgctattgatcctgatgtacggattttggttgta
tcggctttgtctgataaatctacaggtattgaagcattatcgttgggcgccagcgggttt
ctctgtaaacctttttcagaagaagatctcgtagaatctttgtatgagctgatgcaagac
tga

DBGET integrated database retrieval system