Pseudomonas syringae pv. tagetis: MME58_01815 Help Entry MME58_01815       CDS       T08245                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psyi  Pseudomonas syringae pv. tagetis Pathway psyi00998   Biosynthesis of various antibiotics psyi01100   Metabolic pathways psyi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psyi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MME58_01815    00074 Mycolic acid biosynthesis     MME58_01815   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MME58_01815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  UNB69038 LinkDB All DBs Position complement(406242..406496) Genome browser AA seq 84 aa AA seqDB search MQTREDIFEILRTAMVELFELEPERVALDANLYQDLEIDSIDAVDLIDHIKRKTGKKIAA EEFKSVRTVNDVVEAVYKLVNTTE NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaacccgtgaagacatcttcgaaatcctgcgtaccgccatggtggaactgttcgaa ctggaacccgagagggtcgcgcttgacgccaacctttatcaggacctggaaatagacagc atcgatgccgtggacctgatcgaccacatcaaacgcaagaccggcaagaagattgccgct gaagagttcaagtcggtcaggaccgtgaacgacgtggtagaggccgtctacaaactggtc aacaccaccgaatga

DBGET integrated database retrieval system