Psychrosphaera ytuae: J1N51_00250 Help Entry J1N51_00250       CDS       T07123                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psym  Psychrosphaera ytuae Pathway psym01100   Metabolic pathways psym01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psym00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J1N51_00250 (acpP)    00074 Mycolic acid biosynthesis     J1N51_00250 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J1N51_00250 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH Motif Other DBs NCBI-ProteinID:  QTH63966 UniProt:  A0A975DBA8 LinkDB All DBs Position 52127..52360 Genome browser AA seq 77 aa AA seqDB search MSIEDRVAKIVVEQLGVKEEEVKAEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEAE KITTVQSAIDYIKAHAE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcatagaagatcgcgtagctaagatcgttgttgaacaactaggcgtaaaagaagaa gaagtaaaagctgaagcttctttcgtagatgatcttggtgcagattctcttgacactgtt gaattagtaatggctcttgaagaagaattcgatactgaaattccagacgaagaagctgaa aagatcacaacagttcaatcagcgattgattacatcaaagctcacgctgaataa

DBGET integrated database retrieval system