Pseudomonas syringae CC1557: N018_08045 Help Entry N018_08045        CDS       T03014                                  Name (GenBank) anti-sigma-28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism psyr  Pseudomonas syringae CC1557 Pathway psyr02020   Two-component system psyr02025   Biofilm formation - Pseudomonas aeruginosa psyr02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:psyr00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     N018_08045  09140 Cellular Processes   09145 Cellular community - prokaryotes    02025 Biofilm formation - Pseudomonas aeruginosa     N018_08045   09142 Cell motility    02040 Flagellar assembly     N018_08045  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:psyr02035]     N018_08045 Bacterial motility proteins [BR:psyr02035]  Flagellar system   Flagellar assembly proteins    Others     N018_08045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  AHG40199 UniProt:  W0MNQ1 LinkDB All DBs Position complement(1686717..1687031) Genome browser AA seq 104 aa AA seqDB search MVIDFSRLNNSQPAASTSRTGPSKDTAKTDALAPAVTAGVKSTGETFSLSSEAQQLHKIT DKLNDLPTVNSARVAELKQAIADGSYKVDSNRVASKLLNFETQR NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggtcatagattttagccgccttaataattcacagcctgccgccagtacatcgcgtacc gggcccagtaaagacaccgccaaaaccgatgcgctggcacctgcagtcaccgcaggcgtc aaaagcaccggggaaacgttttccttgagcagtgaggctcaacagttgcataaaatcacg gacaagctgaacgatttgcccaccgtcaacagtgcacgcgtcgccgagctcaaacaggcc atcgcagacggtagctataaagtcgacagcaaccgtgttgccagcaaactgttgaatttc gaaacccaacgctaa

DBGET integrated database retrieval system