Primulina tabacum: 142539259 Help Entry 142539259         CDS       T11246                                  Name (RefSeq) putative calmodulin-3   KO K02183   calmodulin Organism ptab  Primulina tabacum Pathway ptab04016   MAPK signaling pathway - plant ptab04070   Phosphatidylinositol signaling system ptab04075   Plant hormone signal transduction ptab04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:ptab00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     142539259    04070 Phosphatidylinositol signaling system     142539259    04075 Plant hormone signal transduction     142539259  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     142539259  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ptab01009]     142539259   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptab04131]     142539259    03036 Chromosome and associated proteins [BR:ptab03036]     142539259   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptab04147]     142539259 Protein phosphatases and associated proteins [BR:ptab01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      142539259 Membrane trafficking [BR:ptab04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     142539259 Chromosome and associated proteins [BR:ptab03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      142539259 Exosome [BR:ptab04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    142539259 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 CFAP251_C EF-hand_FSTL1 AIF-1 EH EF-hand_11 Dockerin_1 SPARC_Ca_bdg EF-hand_EFHB_C DUF5580_M EF-hand_STIM1 EFhand_Ca_insen DUF1103 DUF8640 SAPC2_N Motif Other DBs NCBI-GeneID:  142539259 NCBI-ProteinID:  XP_075500685 LinkDB All DBs Position 3:2257812..2260299 Genome browser AA seq 140 aa AA seqDB search MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEGFRVFDKD QNDFISAAELRHVMTNPGEKLTDEEVDEMIREADVDGDGQINYEEFVKVIDGQVRSKQVE TLLLSRYNHIDEKITPGRLI NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgcgctctttaggacagaacccaacagaggctgaacttcaggatatgatcaacgaggtt gatgctgatggtaatggaacaattgactttcctgagttcctcaacctgatggctcggaaa atgaaggacaccgattctgaggaggagctgaaggaaggtttccgggttttcgacaaggac cagaatgacttcatttctgctgcagaactacgccacgttatgaccaatcctggtgagaag ctcactgatgaggaggtcgatgagatgatccgcgaagcggacgtggatggtgatgggcag atcaactatgaggagttcgtcaaggttattgatggccaagtgagatctaaacaagttgaa actttattattgtccagatataatcatattgacgaaaagataaccccggggaggttaatt tga

DBGET integrated database retrieval system