Primulina tabacum: 142554210
Help
Entry
142554210 CDS
T11246
Name
(RefSeq) SKP1-like protein 1B
KO
K03094
S-phase kinase-associated protein 1
Organism
ptab Primulina tabacum
Pathway
ptab03083
Polycomb repressive complex
ptab04120
Ubiquitin mediated proteolysis
ptab04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
ptab00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
142554210
04120 Ubiquitin mediated proteolysis
142554210
09126 Chromosome
03083 Polycomb repressive complex
142554210
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
ptab04131
]
142554210
04121 Ubiquitin system [BR:
ptab04121
]
142554210
03036 Chromosome and associated proteins [BR:
ptab03036
]
142554210
Membrane trafficking [BR:
ptab04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
142554210
Ubiquitin system [BR:
ptab04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
142554210
Cul7 complex
142554210
Chromosome and associated proteins [BR:
ptab03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
142554210
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
142554210
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID:
142554210
NCBI-ProteinID:
XP_075521010
LinkDB
All DBs
Position
8:41065649..41067669
Genome browser
AA seq
162 aa
AA seq
DB search
MSSQKVIALKSSDGETFEVEEAVAVESQTIKHMIEDNCADTTIPLPIVTSKILAKVIEYC
KRHVESAAKDSSDAVSTDKVVDDDLKNFDTEFVKVDQGTLFDLILAANYLNIKSLLDLTC
QTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE
NT seq
489 nt
NT seq
+upstream
nt +downstream
nt
atgtcttcgcagaaggtgatcgcgttgaagagctcggacggcgagacattcgaggtggag
gaggctgttgctgttgaatctcagactataaagcacatgatcgaggataactgcgccgac
accactatcccgctgcctatcgtcacatccaagatcctcgccaaggtgattgagtactgc
aagcgccacgtcgaatccgccgccaaggattcctccgacgctgtttcgacggacaaggtc
gtcgacgacgacttgaagaatttcgataccgagttcgtgaaggttgatcaggggacgctc
tttgatctgattttggctgcgaactacctaaacatcaagagtttactcgatctcacttgt
caaaccgtggctgacatgatcaaggggaagacacctgaggaaattcgcaagactttcaac
ataaaaaatgactttactccagaggaggaagaagaagttcgcagggagaatgcatgggcg
tttgagtga
DBGET
integrated database retrieval system