KEGG   Pseudomonas taetrolens: NCTC10697_00212
Entry
NCTC10697_00212   CDS       T08085                                 
Symbol
tauD2
Name
(GenBank) alpha-ketoglutarate-dependent taurine dioxygenase TauD
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
ptae  Pseudomonas taetrolens
Pathway
ptae00430  Taurine and hypotaurine metabolism
ptae00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:ptae00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    NCTC10697_00212 (tauD2)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NCTC10697_00212 (tauD2)
Enzymes [BR:ptae01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     NCTC10697_00212 (tauD2)
SSDB
Motif
Pfam: TauD LHH
Other DBs
NCBI-ProteinID: SQF84509
LinkDB
Position
1:complement(207929..208762)
AA seq 277 aa
MSLTITPISAALGAQIDGVDLSLPLSVEHRDAIEQALLRHHVVFFRNQPVTPQQQARFAA
HFGDLHIHPIYPNVPEQPQVLVLDTAVTDVRDNAVWHTDVTFLPTPAMGAVLSAKQLPAF
GGDTLWAAGIAAFEGLSRPLQVLLDGLTATHDFTKSFPLERFGSTPEDLARWEQTRKSNP
PLSHPVIRTHPVSGRKSLFVNEGFTTRINELSEAESEAILKLLFAHATRPEYTLRWRWQE
NDVAFWDNRVTQHYAVDDYRPNRRVMHRATILGDAPF
NT seq 834 nt   +upstreamnt  +downstreamnt
atgagcctgaccattaccccgattagcgctgccctgggtgcccagattgacggcgttgac
ctgagcctgccgctgagcgtggaacaccgtgatgccatcgaacaggcactgctccggcat
cacgttgtgttcttcagaaaccagcccgtcacgccacagcagcaagcacgctttgcagcc
cattttggcgacctgcatatccatcccatctatcccaatgtgcccgagcaaccgcaagta
ctggtgctggacactgccgtcaccgacgtgcgcgacaacgcagtctggcataccgatgtc
accttcttgccgacaccggcgatgggggcggtgctgagtgccaaacaattgcctgctttc
ggaggcgataccttgtgggccgccggcattgcggcgtttgaagggttatccagaccgctt
caagtcctgctggatggactgacggccactcacgacttcaccaagtcattcccgctggag
cgttttggctcaacgccagaagacctggcgcgctgggagcaaacccgcaagagcaacccg
ccgctgtcacacccggtgattcgcacacacccggtgagcgggcgcaaatcgctgttcgtc
aacgaaggcttcaccacccgcatcaatgaactgtccgaagcggaaagcgaagccattttg
aaactgctgttcgcccatgcgacacggccggaatacacccttcgctggcgctggcaggaa
aacgacgtggccttctgggacaaccgcgtgacccagcattacgccgtggatgattaccgc
cccaatcgccgcgtaatgcaccgtgcgactattttgggtgatgcaccgttttaa

DBGET integrated database retrieval system