Pseudomonas taetrolens: NCTC10697_01240 Help Entry NCTC10697_01240   CDS       T08085                                  Symbol acpP_1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptae  Pseudomonas taetrolens Pathway ptae01100   Metabolic pathways ptae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptae00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC10697_01240 (acpP_1)    00074 Mycolic acid biosynthesis     NCTC10697_01240 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC10697_01240 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  SQF85491 LinkDB All DBs Position 1:1270173..1270409 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgttgccgagcaactgggcgtgaaagaa gaagaagtcgttaacactgcttccttcgtagaagacctgggtgccgactcccttgacacc gttgagcttgtgatggctctggaagaggaattcgagactgaaattcctgacgaagaagct gaaaagatcactactgtacaagccgctatcgattacgttactagccaccaggcttaa

DBGET integrated database retrieval system