Pseudomonas taetrolens: NCTC10697_04144 Help Entry NCTC10697_04144   CDS       T08085                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptae  Pseudomonas taetrolens Pathway ptae01100   Metabolic pathways ptae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptae00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC10697_04144    00074 Mycolic acid biosynthesis     NCTC10697_04144   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC10697_04144 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  SQF88322 LinkDB All DBs Position 1:4461142..4461402 Genome browser AA seq 86 aa AA seqDB search MSTLHTEIKQLIIDALGLEDISTQDIGDDQTLFGEGLGLDSVDALELGLAIQKTYGIKID ADAKDTRDHFSSVASLAAFVTAKQAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcactctacacactgaaatcaagcaattgatcatcgacgccctgggcctcgaagac atcagcacccaggacatcggcgacgaccagaccttgttcggcgaaggcctggggctcgac tcggttgacgccctagagctgggcctggcgattcaaaaaacctacggcatcaagatagac gccgacgccaaagacacccgtgatcacttttccagcgtggccagccttgcggcttttgtc accgccaaacaggcagcctga

DBGET integrated database retrieval system