Pseudomonas taetrolens: NCTC10697_04145 Help Entry NCTC10697_04145   CDS       T08085                                  Symbol acpP_2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptae  Pseudomonas taetrolens Pathway ptae01100   Metabolic pathways ptae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptae00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC10697_04145 (acpP_2)    00074 Mycolic acid biosynthesis     NCTC10697_04145 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC10697_04145 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 DUF7080 Motif Other DBs NCBI-ProteinID:  SQF88323 LinkDB All DBs Position 1:4461412..4461666 Genome browser AA seq 84 aa AA seqDB search MQTRDDIFNTLRTALVELFELEPERVTLDANLYQDLEIDSIDAVDLIDHIKRKTGKKIAA EEFKSVRTVNDVVEAVYRLVHPAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaacccgtgacgacatcttcaataccctgcgcaccgctctggtcgaattgttcgag cttgagcccgagcgcgtgaccctggacgccaacctgtatcaggatctggaaatcgacagc atcgatgccgttgacctgattgaccacatcaaacgcaaaaccggcaaaaaaatcgccgcc gaagagttcaagtcggtgcgcaccgtcaacgacgtggttgaggcagtttaccgcctggtt catcccgccgcatga

DBGET integrated database retrieval system