Pseudomonas taiwanensis: ICN73_15045 Help Entry ICN73_15045       CDS       T09297                                  Name (GenBank) chorismate mutase   KO K04782   isochorismate pyruvate lyase [EC:4.2.99.21] Organism ptai  Pseudomonas taiwanensis Pathway ptai01053   Biosynthesis of siderophore group nonribosomal peptides ptai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptai00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01053 Biosynthesis of siderophore group nonribosomal peptides     ICN73_15045 Enzymes [BR:ptai01000]  4. Lyases   4.2  Carbon-oxygen lyases    4.2.99  Other carbon-oxygen lyases     4.2.99.21  isochorismate lyase      ICN73_15045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Osmo_CC HTH_AsnC-type DUF3280 DUF3562 AvrM-A HSBP1 RepL Motif Other DBs NCBI-ProteinID:  QOJ89205 UniProt:  A0A7L9GA01 LinkDB All DBs Position 3366666..3366974 Genome browser AA seq 102 aa AA seqDB search MDVPCTSLDEVRQRIDEIDRSLVSLLAKRGRLVTQAAGFKKTTDDVRAPARVEQVIKKVR EMADETGASAEVVEQVYRAMISAFIAEELNTHAKLADEASAS NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggatgtaccttgcacctctctggacgaagtccgtcaacggatcgatgaaatcgaccgc agcctcgtttcgcttctcgccaaacgtggaaggctcgtaacgcaagcagcgggtttcaag aaaaccaccgatgatgtgcgtgcacccgctcgggtcgagcaagtgatcaagaaggttcgt gagatggctgacgaaaccggtgcctcggctgaggtggtggaacaggtctatcgggcgatg atttcggccttcatcgccgaggagctcaacacccatgcgaagctggccgatgaggcttca gcatcgtga

DBGET integrated database retrieval system