Parageobacillus toebii NBRC 107807: DER53_03975
Help
Entry
DER53_03975 CDS
T06505
Name
(GenBank) NADH-quinone oxidoreductase subunit M
KO
K00342
NADH-quinone oxidoreductase subunit M [EC:
7.1.1.2
]
Organism
ptb
Parageobacillus toebii NBRC 107807
Pathway
ptb00190
Oxidative phosphorylation
ptb01100
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:
ptb00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
DER53_03975
Enzymes [BR:
ptb01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
DER53_03975
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Proton_antipo_M
Oxidored_q5_N
Motif
Other DBs
NCBI-ProteinID:
QIQ32120
LinkDB
All DBs
Position
complement(771523..773049)
Genome browser
AA seq
508 aa
AA seq
DB search
MNGTYFLSLLVFSPLVGILLLAFVPKTQERTIKWLGFLSTLPSLILSLFAFVQYLRGYRL
EHLAEKHDWVRFADFPFLTEPTFAIRYELSIDGFSLVMIVLTSLLATLAAVASIHIKKEW
KGYFMLFLLLEIGMLGVFAAGNMILFFIFLEITLVPMFFLVGKWGGFERERAAYSYLLYN
GIGSAILLIAIIVLFARTGTSNIELVKEMLHNPAVEAQLVAPISNDLRLGLFIALLIAFG
IKLPIVPFHRWILRVHVQAPPSIVMLHSGVLLKIGAYGLIRFGIGLFPDQFRDFAFWIAI
LGVVNLLYGAFLAFVQDDFKMVLAYSSVSHMGIVLIGLGALNEAGIQGAIFQAVSHGFIS
ALLFLLVSILYERTSTTAIDRLGGLAKVMPLTAGCLLAGAMASLGLPGMSGFVSEFTAFL
GLFKTEPVVAAIGALGIIMTAVYLLRAVLNMTFGASKRDDVQALDMSLAEAIPVFVLLAL
IVMIGVYPHILAKPLQATIEMMMNGLGV
NT seq
1527 nt
NT seq
+upstream
nt +downstream
nt
atgaatggaacgtattttctctcccttctcgttttctccccgcttgttggcattcttttg
cttgcgtttgtaccaaaaacgcaagagcggacgataaaatggctcggttttttatctacg
ctgccatcgctgattttatcgctatttgcctttgtacaatatttgcggggctaccgcctg
gaacatttggcagaaaaacacgattgggttcgcttcgcggattttccgtttttaacggag
cccacgttcgccatccgttatgagctgagcatcgacggcttttcgcttgtcatgatcgtg
cttacgtcgctattggcgacgcttgccgccgtcgcctccatccatatcaaaaaagagtgg
aaaggctatttcatgctctttcttctattagaaatcggcatgcttggcgtgtttgcggca
ggaaatatgattttattctttatctttttagaaatcacgctcgttccgatgttcttttta
gttggaaaatggggcggttttgaacgggagcgcgccgcatacagctacttgctttacaac
gggattggttcggcgattttactgattgccattatcgttttatttgcccgcaccgggacg
tccaatatcgagttggtaaaagaaatgcttcataacccggcggtcgaggcgcagcttgtc
gcgccgatttcaaacgatttgcgcttaggattgtttattgcattgttgatcgcatttggg
attaagctgccgatcgttccgtttcaccgctggattttgcgggtgcacgtacaagcgccg
ccgtcgattgtgatgctgcactccggcgtgctattaaaaatcggggcgtacggtttgatt
cggttcggcatcggtttattcccagatcaattccgcgatttcgctttttggattgcgatt
ttaggggttgtcaacttattgtacggagcgtttttagcgttcgtccaagacgattttaaa
atggtgcttgcctattcgagtgtttcccatatgggaattgtgctcattggattgggagcg
ctgaatgaagcagggattcaaggggcgattttccaggctgtttcccatggatttatttcc
gcattgctgttcttgctcgtcagcattttatacgaacgaacgagtacgacggcgatcgac
cgtttaggagggctggcgaaagtgatgccgctgacggcgggatgcttattggcaggagcg
atggcgtcgctcggattgccgggaatgtctgggtttgtaagtgagtttaccgcattttta
ggtttgttcaaaacagagccggtcgttgcggcgatcggtgcgctcggcattattatgacc
gcggtttacctgcttcgcgccgtattgaacatgacgtttggcgcctccaagcgcgatgat
gtacaagcgcttgatatgagcctggcggaagcgattccggtgttcgtattgctcgcattg
attgtgatgatcggcgtatatccgcatattttagcgaaaccattgcaagcgacgattgaa
atgatgatgaacgggttaggagtgtga
DBGET
integrated database retrieval system