Parageobacillus toebii NBRC 107807: DER53_09980 Help Entry DER53_09980       CDS       T06505                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptb  Parageobacillus toebii NBRC 107807 Pathway ptb00998   Biosynthesis of various antibiotics ptb01100   Metabolic pathways ptb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DER53_09980    00074 Mycolic acid biosynthesis     DER53_09980   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DER53_09980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF1493 PP-binding_2 SAPS Motif Other DBs NCBI-ProteinID:  QIQ33084 LinkDB All DBs Position 1924992..1925225 Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVEESQVTLDASFKDDLGADSLDIVELVMELEDEFNMEISDEEA EKIVTVGDAVNYIKSHM NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggcagacgtgttagagcgtgttacgaaaattatcgtcgaccgcttgggtgtcgaagaa tcccaagttacattggatgcttctttcaaagatgatctaggggcagactctctagatatc gtagagcttgtgatggaattagaagatgaatttaatatggaaatttctgatgaagaggct gaaaaaattgtcacagtaggagatgctgtgaactacataaaaagccacatgtaa

DBGET integrated database retrieval system