Parageobacillus toebii NBRC 107807: DER53_13245 Help Entry DER53_13245       CDS       T06505                                  Name (GenBank) hypothetical protein   KO K00626   acetyl-CoA C-acetyltransferase [EC:2.3.1.9] Organism ptb  Parageobacillus toebii NBRC 107807 Pathway ptb00071   Fatty acid degradation ptb00280   Valine, leucine and isoleucine degradation ptb00310   Lysine degradation ptb00362   Benzoate degradation ptb00380   Tryptophan metabolism ptb00620   Pyruvate metabolism ptb00630   Glyoxylate and dicarboxylate metabolism ptb00650   Butanoate metabolism ptb00720   Other carbon fixation pathways ptb00900   Terpenoid backbone biosynthesis ptb01100   Metabolic pathways ptb01110   Biosynthesis of secondary metabolites ptb01120   Microbial metabolism in diverse environments ptb01200   Carbon metabolism ptb01212   Fatty acid metabolism ptb02020   Two-component system Brite KEGG Orthology (KO) [BR:ptb00001]  09100 Metabolism   09101 Carbohydrate metabolism    00620 Pyruvate metabolism     DER53_13245    00630 Glyoxylate and dicarboxylate metabolism     DER53_13245    00650 Butanoate metabolism     DER53_13245   09102 Energy metabolism    00720 Other carbon fixation pathways     DER53_13245   09103 Lipid metabolism    00071 Fatty acid degradation     DER53_13245   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     DER53_13245    00310 Lysine degradation     DER53_13245    00380 Tryptophan metabolism     DER53_13245   09109 Metabolism of terpenoids and polyketides    00900 Terpenoid backbone biosynthesis     DER53_13245   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     DER53_13245  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     DER53_13245  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptb04147]     DER53_13245 Enzymes [BR:ptb01000]  2. Transferases   2.3  Acyltransferases    2.3.1  Transferring groups other than aminoacyl groups     2.3.1.9  acetyl-CoA C-acetyltransferase      DER53_13245 Exosome [BR:ptb04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    DER53_13245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thiolase_C Thiolase_N Thiolase_C_1 DUF6322 Motif Other DBs NCBI-ProteinID:  QIQ33601 LinkDB All DBs Position complement(2608682..2609149) Genome browser AA seq 155 aa AA seqDB search MKRDAVIVSAVRTAIARQGGALATVPAHIFGAEVIKEAMRRANIGTEMVDDVIMGNVLSG GGNIARLTALQTGLSLEINEAFAAQVIACDRELNMNPEKVNVNGGAIAHGHPLGATGAIL ITKAVYELQRSGGRYALITACIGGGQGIATIIERE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgaaacgagatgcggtcattgtttccgccgtccgcacggcgatcgccagacaaggcgga gcattagcgaccgtgccagcgcatatttttggtgcggaagtgataaaagaagcgatgagg cgggcaaatatcggcacggaaatggttgatgatgtcattatgggcaatgtgctaagcggc ggcgggaatatcgcgcggcttacagcattgcaaacaggattatcgcttgaaatcaatgaa gcgtttgccgcccaagtgatcgcctgtgaccgcgaattaaacatgaacccggaaaaagtg aatgtaaacggcggcgcgatcgcccatggccatccgctcggcgcaaccggcgcgatctta attacgaaagccgtgtatgaattgcagcgctcaggcggaagatacgcgctcataacggca tgcatcggcggcgggcaaggaatcgccaccattatcgaacgagaataa

DBGET integrated database retrieval system