Pyrenophora teres: PTT_11246 Help Entry PTT_11246         CDS       T01613                                  Name (GenBank) hypothetical protein   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism pte  Pyrenophora teres Pathway pte03018   RNA degradation pte03040   Spliceosome Brite KEGG Orthology (KO) [BR:pte00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     PTT_11246   09123 Folding, sorting and degradation    03018 RNA degradation     PTT_11246  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pte03019]     PTT_11246    03041 Spliceosome [BR:pte03041]     PTT_11246 Messenger RNA biogenesis [BR:pte03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      PTT_11246   mRNA degradation factors    5'-3' decay     Lsm complex      PTT_11246 Spliceosome [BR:pte03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     PTT_11246  Complex C   U2 snRNP components     PTT_11246 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM Hfq SM-ATX Motif Other DBs NCBI-ProteinID:  EFQ91825 UniProt:  E3RR37 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MLFFSFFKTLVEHEITVELKNEVQIRGTLKSVDQYLNIKLDNAEAVDELRWPHLCSTKDM FIRGSVVRYVHLPSGAVDTALLEDATRREAEAAKNKAK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgctcttcttcagcttcttcaaaacgctcgtcgagcacgaaatcacggtcgaacttaag aacgaagtgcaaatccgcggcacgctaaagagtgtggatcaatatctcaacatcaagctg gacaatgcagaggcggtggatgagctgaggtggccgcatctgtgctcgaccaaagacatg ttcattcgcgggtccgtggttcgatacgtacacctcccctctggcgccgtggacactgcc ttgctcgaggacgcgacgaggagagaggcggaagcggcgaagaacaaggcgaaataa

DBGET integrated database retrieval system