Pyrenophora teres: PTT_14152 Help Entry PTT_14152         CDS       T01613                                  Name (GenBank) hypothetical protein   KO K12625   U6 snRNA-associated Sm-like protein LSm6 Organism pte  Pyrenophora teres Pathway pte03018   RNA degradation pte03040   Spliceosome Brite KEGG Orthology (KO) [BR:pte00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     PTT_14152   09123 Folding, sorting and degradation    03018 RNA degradation     PTT_14152  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pte03019]     PTT_14152    03041 Spliceosome [BR:pte03041]     PTT_14152 Messenger RNA biogenesis [BR:pte03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      PTT_14152   mRNA degradation factors    5'-3' decay     Lsm complex      PTT_14152 Spliceosome [BR:pte03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     PTT_14152 SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX LSM14 Motif Other DBs NCBI-ProteinID:  EFQ89540 UniProt:  E3RXM0 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MSTNGESPAPEAAADSRDPSGFLSEIIGAPVTVKLNSGIIYKGDLQSVDGYMNIALERCK EVADGRVTRNWGDAFVRGNNVTYICADNA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtccaccaacggcgaaagcccagcaccagaagctgctgccgactccagagatcccagt ggcttcctcagcgagatcatcggagctcccgtgactgtcaagctgaactctggaatcatc tacaaaggcgaccttcaatctgtcgatggctacatgaatatcgcactggagcgatgcaaa gaagttgctgatggtcgtgtgacgcgtaattggggggatgccttcgttcgtggaaacaat gtcacatacatctgcgcagataatgcatga

DBGET integrated database retrieval system