Pyrenophora teres: PTT_17826 Help Entry PTT_17826         CDS       T01613                                  Name (GenBank) hypothetical protein   KO K10418   dynein light chain LC8-type Organism pte  Pyrenophora teres Pathway pte04145   Phagocytosis pte04517   IgSF CAM signaling pte04814   Motor proteins Brite KEGG Orthology (KO) [BR:pte00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     PTT_17826  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     PTT_17826   09142 Cell motility    04814 Motor proteins     PTT_17826  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pte03037]     PTT_17826    04812 Cytoskeleton proteins [BR:pte04812]     PTT_17826 Cilium and associated proteins [BR:pte03037]  Motile cilia and associated proteins   Dynein arm    PTT_17826 Cytoskeleton proteins [BR:pte04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      PTT_17826 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light DUF5005 Motif Other DBs NCBI-ProteinID:  EFQ86792 UniProt:  E3S5C4 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MASEKSDTHKQEAQIKSADMSEEMQQEAIEVATMAMEQFTIEKDIAQYIKKEFDSRKGAT WHCIVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcaagcgagaagtcagatacccacaagcaggaagcccagatcaagtcggccgacatg agcgaagagatgcagcaagaagctattgaagtcgcaacgatggctatggagcagttcact attgagaaggacattgcccagtacatcaagaaagagtttgacagccgaaagggtgccaca tggcactgcatcgtaggccgcaactttggaagcttcgtcactcatgagacgaaacatttc atctacttctacctcggccactgcgctattctgctgttcaagacccagtaa

DBGET integrated database retrieval system