KEGG   Pyrenophora teres: PTT_18813
Entry
PTT_18813         CDS       T01613                                 
Name
(GenBank) hypothetical protein
  KO
K03094  S-phase kinase-associated protein 1
Organism
pte  Pyrenophora teres
Pathway
pte03083  Polycomb repressive complex
pte04111  Cell cycle - yeast
pte04120  Ubiquitin mediated proteolysis
pte04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pte00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PTT_18813
   04120 Ubiquitin mediated proteolysis
    PTT_18813
  09126 Chromosome
   03083 Polycomb repressive complex
    PTT_18813
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    PTT_18813
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pte04131]
    PTT_18813
   04121 Ubiquitin system [BR:pte04121]
    PTT_18813
   03036 Chromosome and associated proteins [BR:pte03036]
    PTT_18813
Membrane trafficking [BR:pte04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    PTT_18813
Ubiquitin system [BR:pte04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     PTT_18813
   Cul7 complex
     PTT_18813
Chromosome and associated proteins [BR:pte03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     PTT_18813
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     PTT_18813
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-ProteinID: EFQ86049
UniProt: E3S7K7
LinkDB
Position
Unknown
AA seq 170 aa
MADTTTTQGGKHINITTSDGVSMNVPRPVAERSILIKNLLEDLGGESEESIPIPNVNEAV
MKKVLEWCDHHRNDPPATQDDDSDSRKKSTDIDEWDQKFMQVDQEMLFEIILAANYLDIK
ALLDVGCKTVANMIKGKSPDEIRKTFNIQNDFTPEEEEQIRRENEWAEDR
NT seq 513 nt   +upstreamnt  +downstreamnt
atggccgacactaccaccacccagggcggaaagcacatcaacatcaccaccagcgatggt
gtgtccatgaatgtcccgcgccccgttgccgagcgctccattctcatcaagaacttgctc
gaggaccttggtggtgaatccgaggaatctattccgatccctaatgtgaacgaggcagtc
atgaaaaaggttctcgagtggtgcgaccaccaccgcaatgacccccctgccacacaagac
gacgactcggactcgcgcaagaagtcgaccgacattgacgagtgggaccagaagttcatg
caggttgatcaagaaatgttattcgagatcattctcgctgccaactacctcgacataaag
gcactactcgacgtcggttgcaagaccgttgcgaacatgatcaagggcaagtcccccgat
gaaattcgaaagacgttcaacatccagaatgacttcacgcccgaggaggaggagcagatc
cgtcgcgagaacgagtgggccgaggaccgctag

DBGET integrated database retrieval system