KEGG   Piliocolobus tephrosceles (Ugandan red Colobus): 111525089
Entry
111525089         CDS       T07491                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein isoform X1
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
pteh  Piliocolobus tephrosceles (Ugandan red Colobus)
Pathway
pteh04927  Cortisol synthesis and secretion
pteh04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:pteh00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    111525089 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111525089 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 111525089
NCBI-ProteinID: XP_023046172
Ensembl: ENSPTEG00000012826
LinkDB
Position
19:complement(46726736..46755421)
AA seq 172 aa
MANGTNASAPYYSYEYYLDYLDLILVDEKKLKAHKHSIVIAFWVTLAAFVVLLFLILLYM
SWSGSPQMKNSPKHHQTCPWSHSLSLQLCIRKCLLYHREPLGTSQAQASSVEPASRTGPD
QPRQQGSASTLPRGVFQTHPTLLWELTLNGDPLIRSKPSEPPPGDRTPHLQS
NT seq 519 nt   +upstreamnt  +downstreamnt
atggccaacgggaccaacgcctctgccccatactacagctatgaatactacctggactac
ctggacctcattctcgtagacgagaagaagctgaaagcccacaaacattccatcgtgatc
gcattctgggtgaccctggctgccttcgtggtgctcctcttcctcatcctgctctacatg
tcctggtcgggctccccgcagatgaagaacagccccaagcaccaccaaacatgcccctgg
agtcacagcctcagcctccagctctgcatccggaagtgcctgctgtaccacagggaaccc
ctggggacctcacaggctcaggcgagctcagtggagccagcgagcagaactggccctgac
cagccgcgacaacaggggagcgcctccaccttgccccgtggggttttccagacccacccc
actctcctctgggaactgaccctcaatggggatcccctcatcaggagcaagcccagtgag
cctccccctggagacaggacccctcacctgcagagctga

DBGET integrated database retrieval system